Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mustikkapiirakka (Blueberry Pie)

A rustic Scandinavian blueberry pie with a buttery crust and jammy filling, ready in under an hour. Serve warm with vanilla ice cream or whipped cream.

Total time
55 min
Servings
6
Calories
342
Protein
4g
Mustikkapiirakka (Blueberry Pie)
comfortwholesomescandinavianvegetarianflakysoftjammyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Add cold butter cubes and work together with fingertips until mixture resembles coarse sand.

  2. Step 2

    Sprinkle ice water over dough, 1 tbsp at a time, mixing gently until just combined. Form into a disk, wrap in plastic, chill 20 minutes.

  3. Step 3

    Preheat oven to 400°F. Roll chilled dough to fit a 9-inch pie dish; press in gently. Trim edge and crimp with a fork.

  4. Step 4

    Toss blueberries with sugar and lemon juice in a bowl until coated, about 1 minute.

  5. Step 5

    Pour blueberry mixture into crust, spreading evenly. Bake until crust is golden and filling bubbles at edges, 30–35 minutes.

  6. Step 6

    Cool on a wire rack for 15 minutes before slicing. Serve warm or at room temperature.

Tools you’ll need

  • large mixing bowl
  • 9-inch pie dish
  • rolling pin
  • wire rack
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.