Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Nasi Campur Bali

A vibrant one-pan Indonesian rice bowl topped with crispy eggs, shrimp, and chicken in a savory-sweet soy glaze. Ready in under 30 minutes with minimal dishes.

Total time
25 min
Servings
2
Calories
485
Protein
34g
Nasi Campur Bali
satisfyingfreshindonesianchickenshrimpcrispytenderfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the chicken breast dry with paper towels, then place it on a cutting board and slice it lengthwise (parallel to the longer edge) into strips about 1/4-inch thick, like cutting a deck of cards.

  2. Step 2

    Mince the garlic until the pieces are smaller than a grain of rice — each piece should be about the size of a pencil-tip dot.

  3. Step 3

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  4. Step 4

    Add the chicken strips to the hot oil in a single layer and cook without stirring for 3 minutes until the undersides turn golden and the color climbs halfway up each piece.

  5. Step 5

    Flip each chicken piece and cook for another 2 minutes until the second side is golden and the thickest piece feels firm (not squishy) when pressed with a fork.

  6. Step 6

    Push the chicken to the side of the skillet, then add the shrimp to the empty space and cook for 1 minute until they just turn from gray to pink.

  7. Step 7

    Flip the shrimp and cook for 1 more minute until both sides are pink and the bodies curl into a tight C-shape.

  8. Step 8

    Scatter the minced garlic over the meat and stir everything for 20 seconds until the garlic becomes fragrant (you'll smell a sharp, peppery aroma).

  9. Step 9

    Pour in 3 tablespoons of soy sauce and stir constantly for 30 seconds until the soy coats all the meat and the pan smells deep and umami-rich.

  10. Step 10

    Add the 2 cups of cooked rice to the pan and break up any clumps with a wooden spoon, stirring constantly for 2 minutes until the rice is hot and evenly coated with the soy mixture.

  11. Step 11

    Transfer the rice mixture to two bowls and push to the side to make a small nest in the center of each bowl.

  12. Step 12

    Return the skillet to medium heat and add 1 tablespoon of oil to any remaining space, then crack both eggs into the pan and cover with a lid or foil.

  13. Step 13

    Cook the eggs covered until the whites turn completely opaque and the yolks still jiggle slightly when you shake the pan, about 3 minutes.

  14. Step 14

    Slide one fried egg onto the nest in the center of each rice bowl, keeping the yolk whole and centered.

Tools you’ll need

  • 12-inch skillet with lid or foil cover
  • cutting board
  • chef's knife
  • wooden spoon
  • paper towels
  • fork
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.