Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Nasi Lemak Bowl with Crispy Chicken & Fish

Fragrant coconut rice topped with fried chicken, crispy fish, spicy sambal, and a runny egg — a Malaysian street-food classic that feels fancy but takes 20 minutes flat.

Total time
20 min
Servings
2
Calories
685
Protein
42g
20-Min Nasi Lemak Bowl with Crispy Chicken & Fish
satisfyingboldmalaysianchickenfishcrispyfluffytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add chicken, season with salt and pepper, and cook stirring occasionally until golden and cooked through, 6–7 minutes. Transfer to a plate.

  2. Step 2

    In the same skillet, add 1 tbsp oil. Sear fish pieces without moving for 2 minutes per side until edges are golden and flaky. Season with salt. Transfer to the plate with chicken.

  3. Step 3

    Warm the cooked rice with coconut milk and a pinch of salt in the skillet, stirring gently, for 2 minutes until fragrant and heated through.

  4. Step 4

    Push rice to the side, add 1 tbsp oil, and crack both eggs into the skillet. Fry until whites set but yolks still jiggle, 3–4 minutes.

  5. Step 5

    Divide rice between two bowls. Top each with chicken, fish, a fried egg, and 1.5 tbsp sambal. Squeeze lime over the top and scatter cilantro.

Tools you’ll need

  • large skillet (12-inch minimum)
  • plate
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.