Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

No-Bake Protein Energy Balls

Chewy, satisfying balls packed with oats, nut butter, and protein powder—ready in 10 minutes, no oven needed. Perfect grab-and-go snack or post-workout refuel.

Total time
10 min
Servings
12
Calories
145
Protein
7g
No-Bake Protein Energy Balls
energizingvegetarianvegetarianchewydensesnackpost-workoutsnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine oats, nut butter, protein powder, and honey in a large bowl.

  2. Step 2

    Stir until the mixture forms a thick, slightly wet dough. Add chocolate chips if using.

  3. Step 3

    Scoop mixture into 1-inch balls (about 1 tbsp each) and place on a parchment-lined plate.

  4. Step 4

    Refrigerate 20 minutes until firm, then store in an airtight container up to 1 week.

Tools you’ll need

  • large mixing bowl
  • spoon or spatula
  • parchment paper
  • plate
  • airtight container

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.