Back to recipes
One Minute Oatmeal
Creamy, customizable oatmeal ready in 60 seconds flat. Choose your toppings and make it your own.
- Total time
- 3 min
- Servings
- 1
- Calories
- 238
- Protein
- 7g
quicksimplevegetarianvegetariancreamysoftBreakfastweeknight
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Combine oats, milk, honey, and salt in a microwave-safe bowl.
Step 2
Microwave on high for 60 seconds, stirring halfway through.
Step 3
Stir vigorously until the mixture is smooth and creamy.
Step 4
Top with banana slices. Serve immediately.
Tools you’ll need
- microwave-safe bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
