Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

One-Pot Chili Mac

Ground beef, elbow pasta, and canned chili meet in one skillet for a dinner that tastes like comfort and takes 20 minutes. Brown the beef, dump in the pasta and chili with water, and simmer until creamy.

Total time
20 min
Servings
4
Calories
520
Protein
32g
One-Pot Chili Mac
comfortamericanbeefcreamytenderweeknightpastadinner

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add ground beef and cook, breaking it up with a spoon, until no pink remains, ~5 minutes.

  3. Step 3

    Pour in the elbow pasta, canned chili, and 1 cup water, then stir to combine.

  4. Step 4

    Bring to a simmer, then cook uncovered, stirring occasionally, until pasta is tender, ~8 minutes.

  5. Step 5

    Season with salt and pepper to taste, then serve hot in bowls.

Tools you’ll need

  • large skillet (12-inch or bigger)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.