CookSnap is in beta — Get it free on TestFlight →
Back to recipes

One-Pot Chili Mac

Ground beef, elbow pasta, and canned chili meet in one skillet for a dinner that tastes like comfort and takes 20 minutes. Brown the beef, dump in the pasta and chili with water, and simmer until creamy.

Total time
20 min
Servings
4
Calories
520
Protein
32g
One-Pot Chili Mac
comfortamericanbeefcreamytenderweeknightpastadinner

Ingredients

  • 1 lb ground beef
  • 8 oz elbow macaroni
  • 1 15-oz can canned chili (no beans or with beans, your call)

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add ground beef and cook, breaking it up with a spoon, until no pink remains, ~5 minutes.

  3. 3

    Pour in the elbow pasta, canned chili, and 1 cup water, then stir to combine.

  4. 4

    Bring to a simmer, then cook uncovered, stirring occasionally, until pasta is tender, ~8 minutes.

  5. 5

    Season with salt and pepper to taste, then serve hot in bowls.

Tools you’ll need

  • large skillet (12-inch or bigger)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.