Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

One-Pot Taco Pasta

Ground beef, pasta, and taco seasoning cook together in one skillet with water, topped with melted cheddar for a weeknight dinner that's done in under 20 minutes. No draining, no fuss—just a cheesy, seasoned pasta bowl.

Total time
18 min
Servings
4
Calories
520
Protein
32g
One-Pot Taco Pasta
comfortmexicanbeeftendercheesyweeknightpastadinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Brown ground beef in a 12-inch skillet over medium-high, breaking apart with a spoon, until no pink remains, ~6 minutes.

  2. Step 2

    Add pasta, taco seasoning, and 3 cups water to the skillet and stir well.

  3. Step 3

    Bring to a boil, then reduce heat to medium and simmer uncovered, stirring occasionally, until pasta is tender, ~10 minutes.

  4. Step 4

    Sprinkle cheddar over the top, remove from heat, and stir until cheese melts completely.

  5. Step 5

    Serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet with lid or cover
  • wooden spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.