CookSnap is in beta — Get it free on TestFlight →
Back to recipes

One-Pot Taco Pasta

Ground beef, pasta, and taco seasoning cook together in one skillet with water, topped with melted cheddar for a weeknight dinner that's done in under 20 minutes. No draining, no fuss—just a cheesy, seasoned pasta bowl.

Total time
18 min
Servings
4
Calories
520
Protein
32g
One-Pot Taco Pasta
comfortmexicanbeeftendercheesyweeknightpastadinner

Ingredients

  • 1 lb ground beef
  • 12 oz penne or rotini pasta
  • 2 tbsp taco seasoning
  • 1 cup cheddar cheese, shredded

Instructions

  1. 1

    Brown ground beef in a 12-inch skillet over medium-high, breaking apart with a spoon, until no pink remains, ~6 minutes.

  2. 2

    Add pasta, taco seasoning, and 3 cups water to the skillet and stir well.

  3. 3

    Bring to a boil, then reduce heat to medium and simmer uncovered, stirring occasionally, until pasta is tender, ~10 minutes.

  4. 4

    Sprinkle cheddar over the top, remove from heat, and stir until cheese melts completely.

  5. 5

    Serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet with lid or cover
  • wooden spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.