Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Beef Shank with Creamy Gravy

Tender beef shank seared and finished with a rich, savory gravy, served over creamy mashed potatoes with broccoli and fresh avocado. A weeknight take on French braise that skips the long simmer.

Total time
28 min
Servings
2
Calories
625
Protein
48g
Pan-Seared Beef Shank with Creamy Gravy
comfortheartyfrenchbeeftendercreamyweeknightdinner

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat beef shanks dry with paper towels. Season both sides generously with salt and black pepper.

  2. Step 2

    Heat butter in a large skillet over medium-high until foaming. Sear shanks 3 minutes per side until golden brown. Transfer to a plate.

  3. Step 3

    Pour broth into the skillet, scraping up browned bits. Add mustard and thyme sprigs. Return shanks and simmer 12 minutes until fork-tender.

  4. Step 4

    Remove shanks from pan. Stir cream into the broth over medium heat for 1 minute until sauce thickens slightly. Taste and season with salt and pepper.

  5. Step 5

    Divide mashed potatoes and broccoli between two plates. Top with a beef shank, pour gravy over, and arrange avocado slices on the side.

Tools you’ll need

  • 12-inch skillet or large sauté pan
  • paper towels
  • wooden spoon or spatula
  • tongs
  • two dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.