CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Seared Hungarian Kolbász

Smoky Hungarian pork sausage seared until crispy, finished with a quick sauerkraut and paprika braise. Weeknight comfort that tastes like Budapest in 15 minutes.

Total time
15 min
Servings
4
Calories
520
Protein
34g
Pan-Seared Hungarian Kolbász
comfortcasualhungarianporkcrispytenderweeknightmain-dish

Ingredients

  • 1.5 lb Hungarian kolbász (smoked pork sausage)
  • 2 cups sauerkraut, drained
  • 1 medium yellow onion, sliced thin
  • 1.5 tbsp Hungarian paprika (sweet or hot)
  • ½ tsp caraway seeds
  • ½ cup beef or chicken broth

Instructions

  1. 1

    Slice kolbász on a bias into 1-inch pieces. Heat a large skillet over medium-high until it shimmers.

  2. 2

    Sear sausage pieces 2–3 minutes per side until edges blacken and caramelize. Transfer to a plate.

  3. 3

    In the same skillet, add sliced onion and stir for 2 minutes until softened and fragrant.

  4. 4

    Add paprika and caraway seeds, stir for 30 seconds until the spices bloom and smell toasted.

  5. 5

    Stir in sauerkraut and broth, scraping any browned bits from the bottom. Return sausage to the pan.

  6. 6

    Simmer for 3–4 minutes until liquid reduces slightly and flavors meld. Serve hot from the skillet.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.