Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Hungarian Kolbász

Smoky Hungarian pork sausage seared until crispy, finished with a quick sauerkraut and paprika braise. Weeknight comfort that tastes like Budapest in 15 minutes.

Total time
15 min
Servings
4
Calories
520
Protein
34g
Pan-Seared Hungarian Kolbász
comfortcasualhungarianporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice kolbász on a bias into 1-inch pieces. Heat a large skillet over medium-high until it shimmers.

  2. Step 2

    Sear sausage pieces 2–3 minutes per side until edges blacken and caramelize. Transfer to a plate.

  3. Step 3

    In the same skillet, add sliced onion and stir for 2 minutes until softened and fragrant.

  4. Step 4

    Add paprika and caraway seeds, stir for 30 seconds until the spices bloom and smell toasted.

  5. Step 5

    Stir in sauerkraut and broth, scraping any browned bits from the bottom. Return sausage to the pan.

  6. Step 6

    Simmer for 3–4 minutes until liquid reduces slightly and flavors meld. Serve hot from the skillet.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.