Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Paneer Butter Masala

Creamy tomato-based curry with tender paneer cheese, finished with butter and cream. A comforting vegetarian main that comes together in 30 minutes.

Total time
30 min
Servings
4
Calories
385
Protein
18g
Paneer Butter Masala
comfortindulgentindianvegetarianpaneercreamytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp butter in a large skillet over medium until melted and foamy, ~1 minute.

  2. Step 2

    Add diced onion and cook, stirring, until softened and translucent, ~5 minutes.

  3. Step 3

    Stir in minced garlic and cook until fragrant, ~45 seconds.

  4. Step 4

    Add crushed tomatoes and garam masala, stir to combine.

  5. Step 5

    Simmer uncovered for 8 minutes, stirring occasionally, until sauce thickens slightly.

  6. Step 6

    Stir in heavy cream and remaining 1 tbsp butter until combined.

  7. Step 7

    Gently fold in paneer cubes and simmer for 3 minutes until heated through.

  8. Step 8

    Season with salt and pepper to taste. Serve over rice or with naan.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.