20-Min Pão de Queijo Cheese Bread Balls
Crispy-outside, chewy-inside cheese bread balls that come together in one bowl and bake in 15 minutes. Pure Brazilian comfort — no yeast, no wait.
- Total time
- 20 min
- Servings
- 4
- Calories
- 320
- Protein
- 12g

comfortsimplebrazilianvegetariancheesecrispychewyfluffy
Ingredients
- 1.5 cups tapioca starch
- ¾ cup whole milk
- 2 whole large eggs
- 1 cup shredded Parmesan or Minas cheese
- 3 tbsp olive oil
- ¾ tsp salt
Instructions
- 1
Preheat oven to 400°F. Line a sheet pan with parchment or lightly oil it.
- 2
Combine milk, eggs, and olive oil in a bowl, then whisk until smooth.
- 3
Add tapioca starch, cheese, and salt to the wet mix, stirring until a thick dough forms.
- 4
Scoop dough into golf-ball-sized portions and arrange on the sheet pan.
- 5
Bake for 12–15 minutes until golden and puffed, centers should still be slightly soft.
- 6
Serve warm. They're best eaten fresh, straight from the oven.
Tools you’ll need
- sheet pan (9x13 or larger)
- parchment paper or oil
- mixing bowl
- whisk
- measuring cups and spoons
- spoon or ice-cream scoop
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



