Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Pão de Queijo Cheese Bread Balls

Crispy-outside, chewy-inside cheese bread balls that come together in one bowl and bake in 15 minutes. Pure Brazilian comfort — no yeast, no wait.

Total time
20 min
Servings
4
Calories
320
Protein
12g
20-Min Pão de Queijo Cheese Bread Balls
comfortsimplebrazilianvegetariancheesecrispychewyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment or lightly oil it.

  2. Step 2

    Combine milk, eggs, and olive oil in a bowl, then whisk until smooth.

  3. Step 3

    Add tapioca starch, cheese, and salt to the wet mix, stirring until a thick dough forms.

  4. Step 4

    Scoop dough into golf-ball-sized portions and arrange on the sheet pan.

  5. Step 5

    Bake for 12–15 minutes until golden and puffed, centers should still be slightly soft.

  6. Step 6

    Serve warm. They're best eaten fresh, straight from the oven.

Tools you’ll need

  • sheet pan (9x13 or larger)
  • parchment paper or oil
  • mixing bowl
  • whisk
  • measuring cups and spoons
  • spoon or ice-cream scoop

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.