CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pastel de Feira (Brazilian Street Pastry)

Thin, pillowy fried pastries with a crispy golden shell and soft, chewy interior — the iconic Brazilian street snack. Filled with cheese and herbs, ready in 12 minutes with no special equipment.

Total time
12 min
Servings
4
Calories
285
Protein
8g
Crispy Pastel de Feira (Brazilian Street Pastry)
casualsatisfyingbrazilianvegetariancheesecrispychewyflaky

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup whole milk
  • 1 whole egg
  • 1 cup mozzarella cheese, finely shredded
  • ¼ cup green onion (chopped)
  • 3 cups neutral oil for frying
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Whisk together flour, milk, and egg until smooth. Fold in shredded cheese and green onion. Let batter rest 2 minutes.

  2. 2

    Heat oil in a large heavy skillet over medium-high until a wooden spoon inserted sideways produces a steady stream of bubbles, ~3 minutes.

  3. 3

    Drop spoonfuls of batter into hot oil, working in batches. Don't crowd the pan — pastries should float freely.

  4. 4

    Fry until deep golden brown on the first side, about 2 minutes. Flip carefully with a slotted spoon or tongs.

  5. 5

    Fry the second side until golden, ~90 seconds. Transfer to a paper towel to drain briefly.

  6. 6

    Sprinkle hot pastels lightly with salt and pepper. Serve immediately while still crispy.

Tools you’ll need

  • large heavy skillet (12-inch)
  • whisk
  • wooden spoon
  • slotted spoon or tongs
  • paper towels
  • thermometer (optional but helpful)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.