Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pastel de Feira (Brazilian Street Pastry)

Thin, pillowy fried pastries with a crispy golden shell and soft, chewy interior — the iconic Brazilian street snack. Filled with cheese and herbs, ready in 12 minutes with no special equipment.

Total time
12 min
Servings
4
Calories
285
Protein
8g
Crispy Pastel de Feira (Brazilian Street Pastry)
casualsatisfyingbrazilianvegetariancheesecrispychewyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk together flour, milk, and egg until smooth. Fold in shredded cheese and green onion. Let batter rest 2 minutes.

  2. Step 2

    Heat oil in a large heavy skillet over medium-high until a wooden spoon inserted sideways produces a steady stream of bubbles, ~3 minutes.

  3. Step 3

    Drop spoonfuls of batter into hot oil, working in batches. Don't crowd the pan — pastries should float freely.

  4. Step 4

    Fry until deep golden brown on the first side, about 2 minutes. Flip carefully with a slotted spoon or tongs.

  5. Step 5

    Fry the second side until golden, ~90 seconds. Transfer to a paper towel to drain briefly.

  6. Step 6

    Sprinkle hot pastels lightly with salt and pepper. Serve immediately while still crispy.

Tools you’ll need

  • large heavy skillet (12-inch)
  • whisk
  • wooden spoon
  • slotted spoon or tongs
  • paper towels
  • thermometer (optional but helpful)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.