Pepperoni Pasta Bake
Boil pasta, toss with marinara and pepperoni, top with mozzarella, and bake until bubbly and golden. A 25-minute weeknight dinner that tastes like the pizzeria version.
- Total time
- 25 min
- Servings
- 4
- Calories
- 680
- Protein
- 32g

comfortitalianporkcrispymeltytenderweeknightpasta
Ingredients
- 1 lb penne or rigatoni pasta
- 24 oz marinara sauce
- 6 oz pepperoni slices
- 2 cups mozzarella cheese, shredded
Instructions
- 1
Boil pasta in salted water until al dente, about 9 minutes, then drain.
- 2
Toss hot pasta with marinara sauce and pepperoni slices in a large bowl.
- 3
Transfer mixture to a 9x13-inch baking dish and spread evenly.
- 4
Top with mozzarella cheese in an even layer.
- 5
Bake at 400°F until cheese is melted and edges are golden, 8–10 minutes.
- 6
Let rest 2 minutes, then serve.
Tools you’ll need
- large pot
- colander
- large bowl
- 9x13-inch baking dish
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



