Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pepperoni Pasta Bake

Boil pasta, toss with marinara and pepperoni, top with mozzarella, and bake until bubbly and golden. A 25-minute weeknight dinner that tastes like the pizzeria version.

Total time
25 min
Servings
4
Calories
680
Protein
32g
Pepperoni Pasta Bake
comfortitalianporkcrispymeltytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 9 minutes, then drain.

  2. Step 2

    Toss hot pasta with marinara sauce and pepperoni slices in a large bowl.

  3. Step 3

    Transfer mixture to a 9x13-inch baking dish and spread evenly.

  4. Step 4

    Top with mozzarella cheese in an even layer.

  5. Step 5

    Bake at 400°F until cheese is melted and edges are golden, 8–10 minutes.

  6. Step 6

    Let rest 2 minutes, then serve.

Tools you’ll need

  • large pot
  • colander
  • large bowl
  • 9x13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.