CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pepperoni Pasta Bake

Boil pasta, toss with marinara and pepperoni, top with mozzarella, and bake until bubbly and golden. A 25-minute weeknight dinner that tastes like the pizzeria version.

Total time
25 min
Servings
4
Calories
680
Protein
32g
Pepperoni Pasta Bake
comfortitalianporkcrispymeltytenderweeknightpasta

Ingredients

  • 1 lb penne or rigatoni pasta
  • 24 oz marinara sauce
  • 6 oz pepperoni slices
  • 2 cups mozzarella cheese, shredded

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 9 minutes, then drain.

  2. 2

    Toss hot pasta with marinara sauce and pepperoni slices in a large bowl.

  3. 3

    Transfer mixture to a 9x13-inch baking dish and spread evenly.

  4. 4

    Top with mozzarella cheese in an even layer.

  5. 5

    Bake at 400°F until cheese is melted and edges are golden, 8–10 minutes.

  6. 6

    Let rest 2 minutes, then serve.

Tools you’ll need

  • large pot
  • colander
  • large bowl
  • 9x13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.