Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Perfect Cappuccino

Espresso topped with velvety steamed milk and a whisper of foam—the classic Italian way. Takes 5 minutes, tastes like a café.

Total time
5 min
Servings
1
Calories
85
Protein
4g
Perfect Cappuccino
cozysimpleitalianvegetariancreamysilkybreakfastsnack

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pull 1.5 oz espresso into a cup or use 2–3 tbsp strong brewed coffee.

  2. Step 2

    Pour cold milk into a metal pitcher. Steam until the pitcher is too hot to touch and you hear a steady whisper sound, about 90 seconds.

  3. Step 3

    Gently pour steamed milk into the espresso, holding back foam with a spoon. Fill the cup two-thirds with milk and top with 0.5 inch of foam.

  4. Step 4

    Dust lightly with cocoa powder if desired. Serve immediately.

Tools you’ll need

  • espresso machine with steam wand (or French press for brewed coffee)
  • 8 oz ceramic cup or glass
  • 12 oz stainless steel milk pitcher
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.