Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Picarones con Chancaca

Crispy sweet potato and squash fritters drizzled with warm chancaca—a spiced brown sugar syrup. A beloved Peruvian dessert that's crunchy outside and tender inside.

Total time
35 min
Servings
4
Calories
428
Protein
3g
Picarones con Chancaca
indulgentcomfortperuvianvegetariancrispytenderdessertweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the sweet potato lengthwise in half, then cut each half into 1/4-inch-thick coins by slicing perpendicular to the length, like cutting rounds from a log.

  2. Step 2

    Cut the butternut squash the same way: lengthwise into halves, then into 1/4-inch-thick coins perpendicular to the length.

  3. Step 3

    Place the sweet potato and squash pieces in a large bowl, sprinkle 0.75 cup flour evenly over them, and toss with your hands until all pieces are coated in a thin, even layer of flour.

  4. Step 4

    Pour 3 cups vegetable oil into a 5-quart heavy pot and set it over medium-high heat; wait until the oil shimmers and a single flour-dusted vegetable slice dropped in sizzles immediately and floats, about 4 minutes.

  5. Step 5

    Carefully place 6 to 8 flour-coated squash and sweet potato pieces into the hot oil—do not crowd the pot—and fry until the edges turn deep golden brown and the surface looks crispy, about 3 to 4 minutes, stirring gently once halfway through.

  6. Step 6

    Use a slotted spoon to transfer the fried pieces to a paper-towel-lined plate to drain the excess oil; repeat with remaining vegetable pieces in batches.

  7. Step 7

    Pour 1 cup brown sugar and 0.5 cup water into a 2-quart saucepan and set it over medium heat; stir until the sugar dissolves and the liquid turns amber-colored, about 5 to 6 minutes.

  8. Step 8

    Remove the pan from heat, stir in 0.25 tsp ground cinnamon until fully mixed, then let the syrup cool for 2 minutes so it thickens slightly.

  9. Step 9

    Arrange the warm fried fritters on a serving platter or individual plates, then drizzle the warm chancaca syrup over and around them in a thin, even stream.

Tools you’ll need

  • cutting board
  • sharp chef's knife
  • large mixing bowl
  • 5-quart heavy pot or Dutch oven
  • deep-fry or candy thermometer (optional but helpful)
  • slotted spoon
  • paper towels
  • 2-quart saucepan
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.