Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pissaladière

A Provençal pizza-like tart topped with caramelized onions, anchovies, and olives. Crispy, savory, and utterly addictive—ready in under 50 minutes with store-bought puff pastry.

Total time
45 min
Servings
4
Calories
385
Protein
9g
Pissaladière
rusticelegantfrenchmediterraneanfishcrispytenderweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Place puff pastry sheet on a parchment-lined baking sheet.

  2. Step 2

    Prick the pastry all over with a fork to prevent puffing.

  3. Step 3

    Heat olive oil in a large skillet over medium. Add sliced onions and cook, stirring occasionally, until golden and very soft, 25–30 minutes.

  4. Step 4

    Add minced garlic to the onions and cook for 1 minute until fragrant.

  5. Step 5

    Remove from heat. Stir in lemon juice, salt, and pepper to taste.

  6. Step 6

    Spread caramelized onions evenly over the pastry, leaving a 1/2-inch border.

  7. Step 7

    Arrange anchovy fillets in a crosshatch pattern over the onions.

  8. Step 8

    Scatter olives and thyme over the top.

  9. Step 9

    Bake for 12–15 minutes until the pastry edges are golden brown and crispy.

  10. Step 10

    Cool for 2 minutes. Cut into squares and serve warm or at room temperature.

Tools you’ll need

  • baking sheet
  • parchment paper
  • fork
  • large skillet
  • wooden spoon
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.