Back to recipes
5-Min Pizza English Muffin
Split an English muffin, top with pizza sauce and melted mozzarella, then broil until the cheese bubbles. A crispy, cheesy breakfast toast ready in minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 280
- Protein
- 12g
quickcasualamericanvegetariancrispymeltyweeknightbreakfast
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Split the English muffin in half and place cut-side up on a small baking sheet.
Step 2
Spread 1.5 tablespoons pizza sauce on each muffin half, then top with cheese.
Step 3
Broil 3–4 minutes until the cheese bubbles and edges turn golden.
Step 4
Remove from the broiler and cool 30 seconds before eating.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
