Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pizza Frutti di Mare

A classic Italian seafood pizza with shrimp, mussels, and clams on a crispy crust, finished with fresh garlic, white wine, and parsley. Ready in under 30 minutes using store-bought dough.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Pizza Frutti di Mare
elegantfreshitalianshrimpfishcrispytenderchewy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 500°F and wait for the indicator light or beep, about 10 minutes, so the oven reaches full heat.

  2. Step 2

    Pat the shrimp dry with paper towels by placing each one on the towel and gently pressing until moisture is gone.

  3. Step 3

    Stretch the pizza dough by pulling it gently with both hands until it covers the bottom of a 14-inch round pizza pan or a rectangular sheet pan.

  4. Step 4

    Brush the dough generously with olive oil on all surfaces, then sprinkle salt and pepper evenly across the top and edges.

  5. Step 5

    Bake the crust in the preheated 500°F oven for 8 minutes, until the edges are pale gold and the surface looks slightly puffed.

  6. Step 6

    Remove the pan from the oven, scatter the minced garlic over the crust, then arrange the shrimp and mussels in a single layer across the surface.

  7. Step 7

    Pour the white wine evenly over the shellfish so it pools slightly on the crust, distributing it across the entire pizza.

  8. Step 8

    Return the pizza to the 500°F oven and bake for 7 minutes, until the shrimp turn opaque pink and the mussels open (discard any that don't open).

  9. Step 9

    Remove the pizza from the oven and scatter the fresh parsley over the top in a light, even layer.

  10. Step 10

    Slice the pizza into wedges and serve immediately while the crust is crispy and the seafood is still hot.

Tools you’ll need

  • 14-inch round pizza pan or rectangular sheet pan
  • oven
  • pastry brush
  • paper towels
  • cutting board
  • chef's knife
  • kitchen shears (for mussels, optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.