Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Poached Eggs in Spicy Tomato Sauce

Israeli shakshuka-style poached eggs nestled in a vibrant, gently spiced tomato sauce. A showstopping breakfast that's ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
14g
Poached Eggs in Spicy Tomato Sauce
Israelibreakfastisraelieggvegetarianspicyone-pangluten-free

Ingredients

14 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 3 tbsp olive oil in a large skillet over medium heat. Dice the onion into small pieces and add to the pan, stirring occasionally, until softened and translucent, about 5 minutes.

  2. Step 2

    Mince the 3 garlic cloves and dice the red bell pepper. Add both to the skillet and cook over medium heat, stirring frequently, until fragrant and the pepper begins to soften, about 2-3 minutes.

  3. Step 3

    Stir in the 2 tbsp tomato paste, 1 tsp cumin, 1 tsp paprika, and 0.25 tsp cayenne pepper. Toast the spices for about 1 minute, stirring constantly, until they darken slightly and become fragrant.

  4. Step 4

    Pour in the 14 oz canned crushed tomatoes and stir well to combine all ingredients. Bring the sauce to a gentle simmer over medium-high heat, then reduce heat to medium-low. Season with 0.5 tsp sea salt and 0.25 tsp black pepper. Simmer uncovered for 8-10 minutes, stirring occasionally, until the sauce thickens slightly and flavors meld.

  5. Step 5

    Make 4 small wells or indentations in the simmering sauce using the back of a spoon. Carefully crack each egg into a well, spacing them evenly around the pan. The sauce should surround but not fully cover the eggs.

  6. Step 6

    Cover the skillet with a lid or large plate and poach over medium-low heat for 4-6 minutes. The eggs are done when the whites are set and opaque but the yolks still jiggle slightly when gently shaken. For firmer yolks, cook 1-2 minutes longer.

  7. Step 7

    Remove from heat and sprinkle the 0.25 cup fresh cilantro and 2 tbsp fresh parsley over the top. Serve the skillet family-style, with crusty bread for dipping into the sauce and scooping up each poached egg.

Tools you’ll need

  • Large skillet (10-12 inch)
  • Lid or large plate
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.