CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Polish Potato & Cheese Pierogi

Tender potato and cheese dumplings filled with caramelized onions and crispy fried shallots. A classic Polish comfort dish that's easier than it looks.

Total time
45 min
Servings
4
Calories
425
Protein
12g
Polish Potato & Cheese Pierogi
comfortcozypolishvegetarianvegetariantendercrispyweekend

Ingredients

  • 2 cups all-purpose flour
  • 1 medium, boiled & mashed potato, russet
  • 1 tsp salt
  • 1 lb, boiled & mashed potato, russet
  • ¾ cup sharp cheddar cheese, grated
  • 1 large, sliced thin yellow onion

Instructions

  1. 1

    Stir mashed potatoes and grated cheddar together. Season with salt and pepper. Let cool slightly.

  2. 2

    Mix flour, mashed potato, salt, and 2 tbsp water in a bowl until a soft dough forms.

  3. 3

    Knead 2 minutes until smooth. If too dry, add water 1 tbsp at a time.

  4. 4

    Heat 2 tbsp olive oil in a 12-inch skillet over medium. Add sliced onion and cook 15 minutes, stirring every few minutes, until deep golden brown.

  5. 5

    Season with salt and pepper. Transfer to a plate.

  6. 6

    Divide dough into 12 balls. On a floured surface, flatten each into a 2-inch circle.

  7. 7

    Place 1 tbsp filling in the center of each circle. Fold dough over and press edges to seal firmly.

  8. 8

    Bring a large pot of salted water to a boil. Working in batches, add pierogi and cook until they float, then 2 minutes more. Transfer to a plate with a slotted spoon.

  9. 9

    Heat 1 tbsp olive oil in the same skillet over medium-high. Pan-fry pierogi in batches until bottoms are golden and edges curl slightly, about 3 minutes per side.

  10. 10

    Top with caramelized onions. Serve hot with sour cream on the side.

Tools you’ll need

  • medium bowl
  • 12-inch skillet
  • large pot
  • slotted spoon
  • floured work surface
  • measuring cups & spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.