Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Polish Potato & Cheese Pierogi

Tender potato and cheese dumplings filled with caramelized onions and crispy fried shallots. A classic Polish comfort dish that's easier than it looks.

Total time
45 min
Servings
4
Calories
425
Protein
12g
Polish Potato & Cheese Pierogi
comfortcozypolishvegetarianvegetariantendercrispyweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir mashed potatoes and grated cheddar together. Season with salt and pepper. Let cool slightly.

  2. Step 2

    Mix flour, mashed potato, salt, and 2 tbsp water in a bowl until a soft dough forms.

  3. Step 3

    Knead 2 minutes until smooth. If too dry, add water 1 tbsp at a time.

  4. Step 4

    Heat 2 tbsp olive oil in a 12-inch skillet over medium. Add sliced onion and cook 15 minutes, stirring every few minutes, until deep golden brown.

  5. Step 5

    Season with salt and pepper. Transfer to a plate.

  6. Step 6

    Divide dough into 12 balls. On a floured surface, flatten each into a 2-inch circle.

  7. Step 7

    Place 1 tbsp filling in the center of each circle. Fold dough over and press edges to seal firmly.

  8. Step 8

    Bring a large pot of salted water to a boil. Working in batches, add pierogi and cook until they float, then 2 minutes more. Transfer to a plate with a slotted spoon.

  9. Step 9

    Heat 1 tbsp olive oil in the same skillet over medium-high. Pan-fry pierogi in batches until bottoms are golden and edges curl slightly, about 3 minutes per side.

  10. Step 10

    Top with caramelized onions. Serve hot with sour cream on the side.

Tools you’ll need

  • medium bowl
  • 12-inch skillet
  • large pot
  • slotted spoon
  • floured work surface
  • measuring cups & spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.