Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Pork & Chestnut Zongzi

Glutinous rice parcels folded in bamboo leaves with savory pork and chestnut filling. A TikTok-friendly shortcut to the classic: pre-cooked bamboo leaves, store-bought glutinous rice, and a quick-seared pork filling.

Total time
25 min
Servings
4
Calories
420
Protein
16g
25-Min Pork & Chestnut Zongzi
comfortrusticchineseporkchewytenderweeknightmeal-prep

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp neutral oil in a skillet over medium-high. Add ground pork and cook, breaking apart with a spoon, until no pink remains, ~5 minutes.

  2. Step 2

    Stir in minced ginger, soy sauce, and sesame oil. Fold in chestnut halves and scallions. Taste and adjust seasoning; set filling aside.

  3. Step 3

    Lay one bamboo leaf shiny-side down. Place 2 tbsp sticky rice in the center, then 1 tbsp pork-chestnut filling on top. Fold leaf into a tight pyramid: fold bottom corner up, then left and right corners over the top, tucking the final flap underneath.

  4. Step 4

    Repeat with remaining leaves, rice, and filling until all are wrapped (makes 8 zongzi).

  5. Step 5

    Bring a pot of salted water to boil. Submerge all zongzi and simmer for 10 minutes until they float and stay submerged.

  6. Step 6

    Remove zongzi with a slotted spoon and drain briefly. Serve hot with extra soy sauce or chili oil for dipping.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • large pot
  • slotted spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.