Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

30-Min Pork Zongzi with Sticky Rice

Glutinous rice + savory pork parcels steamed in bamboo leaves. Skip the 2-hour soak; use a quick sear-and-steam method to get restaurant-style zongzi texture in under 30 minutes.

Total time
30 min
Servings
4
Calories
520
Protein
24g
30-Min Pork Zongzi with Sticky Rice
comfortcasualchineseporkstickytenderweeknightmeal-prep

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse glutinous rice twice under cold water until water runs clear, then drain.

  2. Step 2

    Brown diced pork in a skillet over medium-high heat, stirring, until no pink remains, about 5 minutes.

  3. Step 3

    Add soy sauce, sesame oil, ginger, and scallions to pork. Stir for 30 seconds until fragrant, then remove from heat.

  4. Step 4

    Mix cooked rice with the pork filling in a bowl. Let cool 2 minutes so bamboo leaves don't wilt from steam when wrapping.

  5. Step 5

    Place 3 tbsp rice-pork mixture in the center of each bamboo leaf, fold into a pyramid, and secure with kitchen twine.

  6. Step 6

    Add 1 inch of water to a large pot, place steamer basket inside, arrange zongzi seam-side down, and steam covered for 10 minutes.

Tools you’ll need

  • 12-inch skillet
  • large pot
  • bamboo steamer basket
  • kitchen twine
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.