Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Potato Dumplings with Brown Butter

Pillowy pan-fried potato dumplings with crispy edges and a nutty brown butter sauce. A German comfort classic that tastes fancy but comes together in one skillet.

Total time
18 min
Servings
2
Calories
385
Protein
9g
Potato Dumplings with Brown Butter
comfortwholesomegermanvegetarianvegetariancrispytenderfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until just fork-tender, about 10 minutes. Drain and let cool slightly, then peel and press through a ricer into a bowl.

  2. Step 2

    Fold flour, egg, nutmeg, salt, and pepper into potatoes until a soft dough forms. Divide into 8 balls, flatten slightly into thick patties.

  3. Step 3

    Heat 2 tbsp butter in a large skillet over medium-high. Pan-fry half the dumplings 3 minutes per side until edges turn golden and crispy.

  4. Step 4

    Transfer cooked dumplings to a plate. Add remaining 2 tbsp butter to the skillet and repeat with the second batch.

  5. Step 5

    Return all dumplings to the skillet. Lower heat to medium. Add butter to the pan and let it foam and brown, ~90 seconds, stirring gently to coat.

  6. Step 6

    Sprinkle parsley over the dumplings. Serve immediately while crispy and warm.

Tools you’ll need

  • large pot for boiling
  • ricer or masher
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.