Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quiche aux Épinards

A classic French spinach quiche with a buttery crust, creamy custard, and earthy wilted spinach. Elegant enough for dinner, simple enough for any home cook.

Total time
50 min
Servings
4
Calories
485
Protein
16g
Quiche aux Épinards
elegantcomfortablefrenchvegetarianeggscheesecreamyflaky

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and 0.5 tsp salt in a bowl. Add cold butter and rub with your fingers until mixture looks like breadcrumbs.

  2. Step 2

    Add ice water 1 tbsp at a time, tossing gently, until dough just holds together when squeezed.

  3. Step 3

    Form dough into a flat disk, wrap in plastic, and refrigerate for 15 minutes.

  4. Step 4

    Roll dough to 1/8-inch thick on a floured surface. Transfer to a 9-inch pie dish and trim edges.

  5. Step 5

    Prick bottom with a fork. Line with parchment and fill with dried beans or weights.

  6. Step 6

    Bake at 375°F for 12 minutes until pale. Remove parchment and weights.

  7. Step 7

    Heat 1 tbsp butter in a large skillet over medium. Sauté shallot until soft, about 2 minutes.

  8. Step 8

    Add spinach in batches and stir until wilted and any liquid evaporates, 3–4 minutes total.

  9. Step 9

    Whisk eggs and cream in a bowl with nutmeg, 0.5 tsp salt, and black pepper to taste.

  10. Step 10

    Stir spinach and shallot into egg mixture. Fold in gruyère.

  11. Step 11

    Pour custard into the par-baked crust. Smooth the surface.

  12. Step 12

    Bake at 375°F for 25–30 minutes until the center is set but still jiggles slightly when shaken.

  13. Step 13

    Let rest for 5 minutes before slicing. Serve warm or at room temperature.

Tools you’ll need

  • mixing bowl
  • 9-inch pie dish
  • rolling pin
  • fork
  • parchment paper
  • dried beans or pie weights
  • large skillet
  • wooden spoon
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.