Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Argentine Veggie Tart with Creamy Sauce

Buttery puff pastry layered with sautéed zucchini, bell pepper, and onion, finished with a garlicky sour cream sauce. Ready in 20 minutes — no rolling required.

Total time
20 min
Servings
2
Calories
385
Protein
6g
Quick Argentine Veggie Tart with Creamy Sauce
simplecasualargentinianvegetarianvegetarianflakytendercreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add onion, zucchini, and bell pepper. Sauté, stirring often, until vegetables soften and edges curl, 6–7 minutes.

  3. Step 3

    Stir in minced garlic and cook 30 seconds until fragrant, then remove from heat.

  4. Step 4

    Toast puff pastry sheets in a dry skillet or toaster oven (or microwave 45 seconds) until just warm and pliable.

  5. Step 5

    Divide sautéed vegetables between the two pastry sheets, spreading them evenly across the surface.

  6. Step 6

    Stir sour cream with a pinch of salt and pepper, then drizzle over top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • toaster oven or microwave

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.