Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Gujarati Thali

A simplified vegetarian thali with fluffy flatbread, spiced chickpeas, and cooling yogurt raita — ready in under 30 minutes. Authentic flavors, minimal fuss.

Total time
28 min
Servings
2
Calories
485
Protein
18g
Quick Gujarati Thali
comfortsatisfyingindianvegetarianchickpeasfluffycreamytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 0.75 cup yogurt into a small bowl and stir gently with a spoon until smooth, about 30 seconds; set aside.

  2. Step 2

    Cut the onion in half lengthwise from root to tip, then slice each half crosswise into thin half-rings about 1/8 inch thick.

  3. Step 3

    In a medium bowl, stir the flour with a pinch of salt, then add 0.25 cup water slowly while mixing with your fingers until a soft, slightly sticky dough forms, about 2 minutes.

  4. Step 4

    Heat 1 tablespoon olive oil in a 10-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. Step 5

    Add the sliced onion and cook, stirring once every 30 seconds, until the edges turn golden brown and the onion softens, about 3 minutes.

  6. Step 6

    Stir in 1 tablespoon ginger-garlic paste and cook, stirring constantly, until it smells strongly fragrant and there is no raw garlic smell left, about 45 seconds.

  7. Step 7

    Add 1.5 teaspoons of the cumin-chili powder mix and stir for 20 seconds until the spices smell toasted and coat the onions.

  8. Step 8

    Pour in the drained chickpeas and 0.25 cup water, then stir to combine; reduce heat to medium and simmer without stirring for 5 minutes until the chickpeas soften slightly.

  9. Step 9

    Taste and add a small pinch of salt and pepper; stir once and remove from heat.

  10. Step 10

    Divide the dough into two equal pieces and roll each one between your palms into a smooth ball.

  11. Step 11

    On a lightly floured surface, use a rolling pin or the base of a glass to flatten each ball into a thin round about 6 inches wide and 1/8 inch thick.

  12. Step 12

    Heat a second 10-inch skillet or griddle over medium-high heat until a drop of water sizzles and evaporates in 2 seconds.

  13. Step 13

    Place one flatbread round onto the hot skillet and cook without touching it until large bubbles appear across the surface and the bottom has light golden spots, about 2 minutes.

  14. Step 14

    Flip the flatbread and cook the other side until it puffs slightly and develops golden spots, about 1 minute.

  15. Step 15

    Transfer the cooked flatbread to a plate and repeat with the remaining dough.

  16. Step 16

    Place one flatbread on each plate and top the center with half of the warm chickpea curry.

  17. Step 17

    Dollop half of the plain yogurt alongside the curry on each plate.

Tools you’ll need

  • small bowl
  • cutting board
  • chef's knife
  • medium mixing bowl
  • 10-inch skillet
  • wooden spoon
  • second 10-inch skillet or griddle
  • rolling pin or drinking glass base
  • spatula
  • dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.