Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Hu Tieu Mi

Vietnamese mixed noodle soup with shrimp and pork in a fragrant broth, ready in under 30 minutes. A light, satisfying weeknight dinner that balances savory, tangy, and fresh flavors.

Total time
25 min
Servings
2
Calories
285
Protein
28g
Quick Hu Tieu Mi
lightsatisfyingvietnameseshrimpporktenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour the broth into a large pot and bring it to a boil over high heat, about 5 minutes. You will see large bubbles rapidly breaking on the surface.

  2. Step 2

    Add the tamarind paste and fish sauce to the boiling broth, stirring for 30 seconds until dissolved. The broth should smell sour and savory.

  3. Step 3

    Add the noodles and stir once with a wooden spoon to separate them, about 15 seconds. Return the broth to a boil.

  4. Step 4

    Cook the noodles at a rolling boil for 5 minutes, stirring once halfway through, until they are tender but still slightly firm when you bite one.

  5. Step 5

    Add the shrimp and cooked pork to the pot and stir once. Cook at a medium boil for 3 minutes until the shrimp are firm and pink on all sides.

  6. Step 6

    Pour the soup into two bowls, dividing the noodles, shrimp, and pork evenly between them.

  7. Step 7

    Scatter the chopped herbs over the top of each bowl and serve immediately while hot.

Tools you’ll need

  • large pot (4-quart or larger)
  • wooden spoon
  • two soup bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.