Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Kashmiri Dum Aloo with Green Chilies

Crispy baby potatoes in a rich tomato-cream sauce with Kashmiri spices and fresh green chilies. Ready in 20 minutes—the weeknight version of a classic.

Total time
20 min
Servings
2
Calories
485
Protein
6g
Quick Kashmiri Dum Aloo with Green Chilies
comfortindulgentindianvegetarianvegetariancrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 3 tbsp oil in a large skillet over medium-high until shimmering. Add potatoes and cook, stirring occasionally, until golden brown and nearly tender, about 8–10 minutes.

  2. Step 2

    Stir in ginger-garlic paste and cook until fragrant, about 30 seconds. Add tomato paste and Kashmiri chili powder, stirring to coat.

  3. Step 3

    Pour in cream and 0.5 cup water. Add sliced green chilies, salt, and a pinch of black pepper. Simmer until potatoes are tender and sauce thickens, about 5 minutes.

  4. Step 4

    Taste and adjust salt and spice. Serve hot with naan or basmati rice.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • wooden spoon or spatula
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.