CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Quick Kashmiri Dum Aloo with Green Chilies

Crispy baby potatoes in a rich tomato-cream sauce with Kashmiri spices and fresh green chilies. Ready in 20 minutes—the weeknight version of a classic.

Total time
20 min
Servings
2
Calories
485
Protein
6g
Quick Kashmiri Dum Aloo with Green Chilies
comfortindulgentindianvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 1 lb baby potatoes, halved
  • 3 tbsp tomato paste
  • ½ cup heavy cream
  • 2 whole green chilies, sliced
  • 1.5 tsp Kashmiri chili powder
  • 1 tbsp ginger-garlic paste

Instructions

  1. 1

    Heat 3 tbsp oil in a large skillet over medium-high until shimmering. Add potatoes and cook, stirring occasionally, until golden brown and nearly tender, about 8–10 minutes.

  2. 2

    Stir in ginger-garlic paste and cook until fragrant, about 30 seconds. Add tomato paste and Kashmiri chili powder, stirring to coat.

  3. 3

    Pour in cream and 0.5 cup water. Add sliced green chilies, salt, and a pinch of black pepper. Simmer until potatoes are tender and sauce thickens, about 5 minutes.

  4. 4

    Taste and adjust salt and spice. Serve hot with naan or basmati rice.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • wooden spoon or spatula
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.