Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Ramen Broth from Scratch

A fragrant, umami-rich broth built on kombu, ginger, and garlic in under 45 minutes. Perfect base for noodles, vegetables, and toppings.

Total time
45 min
Servings
4
Calories
35
Protein
1g
Quick Ramen Broth from Scratch
comfortcozyjapanesevegetarianvegandairy-freesmoothSoup

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Wipe kombu with a damp cloth to remove surface dust—do not rinse.

  2. Step 2

    Pour water into a large pot and add kombu. Heat over medium until steaming but not quite boiling, ~8 minutes.

  3. Step 3

    Remove from heat just before the first bubble breaks. Remove kombu and discard.

  4. Step 4

    Return pot to medium heat. Add ginger and garlic. Simmer gently for 20 minutes until broth is fragrant.

  5. Step 5

    Stir in soy sauce and mirin. Taste and adjust salt and pepper.

  6. Step 6

    Strain through a fine-mesh sieve into a bowl. Discard solids.

  7. Step 7

    Use broth immediately for ramen, or cool and refrigerate up to 5 days.

Tools you’ll need

  • large pot (6-quart or larger)
  • fine-mesh sieve or strainer
  • spoon for stirring
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.