Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Sausage Marinara Spaghetti

Crumbled Italian sausage browned with marinara sauce, tossed with spaghetti and finished with Parmesan. A weeknight staple that tastes restaurant-ready in 20 minutes.

Total time
20 min
Servings
4
Calories
640
Protein
38g
20-Min Sausage Marinara Spaghetti
comfortamericanporktendercreamyweeknightpastadinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil spaghetti in salted water until al dente, about 10 minutes.

  2. Step 2

    While pasta cooks, brown sausage in a large skillet over medium-high, breaking up with a spoon, 6–8 minutes.

  3. Step 3

    Pour marinara sauce into the skillet and simmer 3 minutes until warmed through.

  4. Step 4

    Drain pasta and add it to the skillet, tossing to coat.

  5. Step 5

    Divide among bowls and top with Parmesan.

Tools you’ll need

  • large pot for pasta water
  • large skillet (12-inch preferred)
  • wooden spoon
  • colander
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.