CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Sausage Marinara Spaghetti

Crumbled Italian sausage browned with marinara sauce, tossed with spaghetti and finished with Parmesan. A weeknight staple that tastes restaurant-ready in 20 minutes.

Total time
20 min
Servings
4
Calories
640
Protein
38g
20-Min Sausage Marinara Spaghetti
comfortamericanporktendercreamyweeknightpastadinner

Ingredients

  • 1 lb spaghetti
  • 1 lb Italian sausage, casings removed
  • 24 oz marinara sauce
  • ½ cup Parmesan cheese, grated

Instructions

  1. 1

    Boil spaghetti in salted water until al dente, about 10 minutes.

  2. 2

    While pasta cooks, brown sausage in a large skillet over medium-high, breaking up with a spoon, 6–8 minutes.

  3. 3

    Pour marinara sauce into the skillet and simmer 3 minutes until warmed through.

  4. 4

    Drain pasta and add it to the skillet, tossing to coat.

  5. 5

    Divide among bowls and top with Parmesan.

Tools you’ll need

  • large pot for pasta water
  • large skillet (12-inch preferred)
  • wooden spoon
  • colander
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.