5-Min Sesame Chicken Slaw
Shredded rotisserie chicken tossed with crispy coleslaw and a nutty sesame-soy dressing. Ready in under 5 minutes — no cooking required.
- Total time
- 5 min
- Servings
- 2
- Calories
- 342
- Protein
- 28g

freshlightasiangluten-freechickencrispytenderweeknight
Ingredients
- 2 cups rotisserie chicken, shredded
- 4 cups coleslaw mix
- 3 tbsp sesame oil
- 2 tbsp soy sauce
Instructions
- 1
Whisk sesame oil and soy sauce together in a large bowl until combined.
- 2
Add shredded chicken and coleslaw mix to the bowl.
- 3
Toss everything until the slaw is well coated and glistening.
- 4
Divide between bowls or plates and serve immediately.
Tools you’ll need
- large bowl
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



