Back to recipes
5-Min Sesame Chicken Slaw
Shredded rotisserie chicken tossed with crispy coleslaw and a nutty sesame-soy dressing. Ready in under 5 minutes — no cooking required.
- Total time
- 5 min
- Servings
- 2
- Calories
- 342
- Protein
- 28g
freshlightasiangluten-freechickencrispytenderweeknight
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Whisk sesame oil and soy sauce together in a large bowl until combined.
Step 2
Add shredded chicken and coleslaw mix to the bowl.
Step 3
Toss everything until the slaw is well coated and glistening.
Step 4
Divide between bowls or plates and serve immediately.
Tools you’ll need
- large bowl
- whisk
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
