Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sfogliatelle (Crispy Shells)

Golden, shatteringly crisp pastry shells filled with sweet ricotta and candied citrus. These Neapolitan pastries look showstopping but use store-bought phyllo for speed.

Total time
45 min
Servings
4
Calories
385
Protein
8g
Sfogliatelle (Crispy Shells)
elegantindulgentitalianvegetariancrispyflakycreamyweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Pour 1 cup ricotta into a medium bowl, add 0.5 cup powdered sugar, and stir with a wooden spoon until the mixture looks uniform and creamy, about 1 minute.

  3. Step 3

    Fold the chopped candied orange peel and 0.25 cup chocolate chips into the ricotta mixture using a rubber spatula—lift batter from the bottom up and over the mix, rotating the bowl a quarter turn; repeat until evenly distributed, about 30 seconds.

  4. Step 4

    Place a phyllo sheet on your work surface and brush the entire top side lightly with melted butter using a pastry brush, moving from edge to edge until the surface glistens.

  5. Step 5

    Lay a second phyllo sheet directly on top of the buttered first sheet, then brush the top of this new sheet with melted butter the same way.

  6. Step 6

    Repeat this layering process until you have stacked 3 phyllo sheets total, each brushed with butter.

  7. Step 7

    Spoon 3 tablespoons of the ricotta filling onto the short end of the phyllo stack, leaving a 1-inch border along the edge, then fold the phyllo tightly around the filling like wrapping a burrito.

  8. Step 8

    Place the rolled sfogliatella seam-side down on a parchment-lined baking sheet and repeat steps 4–7 three more times with the remaining 9 phyllo sheets and filling, making 4 pastries total.

  9. Step 9

    Brush the top of each rolled sfogliatella with a light coat of melted butter, then sprinkle 0.125 teaspoon salt evenly over all 4 pastries.

  10. Step 10

    Place the baking sheet in the preheated oven and bake until the pastry turns the color of dark honey and feels crispy to the touch, about 20–25 minutes.

  11. Step 11

    Remove the baking sheet from the oven and let the sfogliatelle cool on the sheet for 5 minutes so they set and become even crispier.

Tools you’ll need

  • oven
  • medium mixing bowl
  • wooden spoon
  • rubber spatula
  • work surface (cutting board or counter)
  • pastry brush
  • baking sheet
  • parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.