Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shakshuka — Baked Eggs in Tomato Sauce

Spiced tomato sauce bubbling in a skillet with eggs nestled on top and baked until whites set but yolks stay runny. Tear crusty bread and dip into the rich, tangy sauce — total comfort on a plate.

Total time
20 min
Servings
2
Calories
285
Protein
14g
Shakshuka — Baked Eggs in Tomato Sauce
comfortrusticmediterraneanvegetarianeggscreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a 10-inch skillet over medium heat. Add diced onion and sauté until softened and translucent, about 4 minutes.

  2. Step 2

    Add minced garlic and cook for 30 seconds until fragrant, then pour in crushed tomatoes with a pinch each of salt and pepper.

  3. Step 3

    Simmer the sauce for 5 minutes, stirring occasionally, until it darkens slightly and flavors meld.

  4. Step 4

    Create four small wells in the sauce with the back of a spoon. Crack an egg into each well.

  5. Step 5

    Cover the skillet and cook over medium-low heat for 4–5 minutes until egg whites are set but yolks still jiggle when you shake the pan.

  6. Step 6

    Serve the skillet hot with sliced bread alongside for dipping into the sauce and breaking the runny yolks.

Tools you’ll need

  • 10-inch skillet with lid
  • cutting board
  • knife
  • wooden spoon
  • small bowl or cup for cracking eggs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.