CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet Pan Bratwurst with Sauerkraut & Fried Onions

Sausages and tangy sauerkraut roast together on one pan while potatoes crisp up with fried onions on the side. Mustard ties it all together in under 25 minutes.

Total time
25 min
Servings
2
Calories
620
Protein
28g
Sheet Pan Bratwurst with Sauerkraut & Fried Onions
comfortheartygermanporkcrispytenderweeknightmain-dish

Ingredients

  • 4 links bratwurst
  • 2 cups sauerkraut, drained
  • 3 tbsp mustard
  • 2 cups mashed potatoes
  • ½ cup fried onions (store-bought)

Instructions

  1. 1

    Preheat oven to 400°F and place bratwurst on a sheet pan.

  2. 2

    Spread sauerkraut around the sausages and drizzle with 1 tbsp oil.

  3. 3

    Roast for 18–20 minutes until sausages are golden and cooked through.

  4. 4

    Warm mashed potatoes in a bowl or microwave for 2 minutes while sausages finish.

  5. 5

    Top potatoes with fried onions, then plate alongside the bratwurst and sauerkraut.

  6. 6

    Serve with mustard on the side or smeared on the sausages.

Tools you’ll need

  • sheet pan
  • oven
  • bowl or microwave-safe container

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.