Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Focaccia Barese

Pillowy, olive-oil-soaked focaccia with crispy edges and dimpled tops, finished with tomatoes and herbs. Baked on one sheet pan in under 20 minutes using store-bought dough.

Total time
18 min
Servings
4
Calories
312
Protein
6g
Sheet-Pan Focaccia Barese
comfortsimpleitalianvegetariancrispyfluffysoftBread

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Stretch dough into a 9×13-inch rectangle on a sheet pan coated with 1 tbsp olive oil.

  2. Step 2

    Use your fingertips to create deep dimples all over the surface, pushing down until your finger hits the pan.

  3. Step 3

    Drizzle remaining oil over dough. Scatter tomatoes, garlic, and rosemary into and around the dimples.

  4. Step 4

    Sprinkle coarse salt over top. Bake until edges are deep golden and surface is set, 12–14 minutes.

  5. Step 5

    Cool 2 minutes in the pan, then slide onto a cutting board and slice into squares or rectangles.

Tools you’ll need

  • 13×9-inch sheet pan
  • oven
  • fingertips
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.