Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Greek Chicken Quinoa Bowl

Roasted chicken thighs and cherry tomatoes on a bed of fluffy quinoa, finished with a lemon-herb dressing and topped with creamy feta and crispy red onion. One pan, 25 minutes, Mediterranean comfort.

Total time
25 min
Servings
2
Calories
620
Protein
48g
Sheet-Pan Greek Chicken Quinoa Bowl
freshhealthygreekmediterraneanchickencrispytenderfluffy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry. Toss with 2 tbsp oil, salt, pepper, and half the dill. Spread on a sheet pan alongside halved tomatoes.

  2. Step 2

    Roast at 425°F until chicken is golden and internal temp hits 165°F, about 15 minutes.

  3. Step 3

    While chicken roasts, thinly slice red onion. Toss in a bowl with a pinch of salt to soften, about 2 minutes.

  4. Step 4

    Whisk remaining 2 tbsp oil with lemon juice, remaining dill, salt, and pepper for dressing.

  5. Step 5

    Divide warm quinoa between bowls. Top with roasted chicken, tomatoes, red onion, and feta.

  6. Step 6

    Drizzle lemon-herb dressing over everything. Serve immediately.

Tools you’ll need

  • sheet pan
  • mixing bowl
  • small bowl
  • whisk
  • meat thermometer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.