Back to recipes
Sheet Pan Sausage & Potatoes
Smoked sausage and baby potatoes roast together on one pan with Italian seasoning for a no-fuss weeknight dinner. Ready in under 25 minutes.
- Total time
- 25 min
- Servings
- 4
- Calories
- 410
- Protein
- 22g
comfortcasualamericanporkcrispytenderweeknightmain-dish
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 425°F, then cut sausage into 2-inch pieces and halve large potatoes.
Step 2
Toss sausage and potatoes with oil, Italian seasoning, salt, and pepper on a sheet pan.
Step 3
Spread in a single layer and roast for 20 minutes, shaking the pan halfway through.
Step 4
Potatoes should be golden and tender; sausage edges should be caramelized.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
