Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Shito Chicken

Crispy pan-fried chicken bathed in Ghanaian shito—a punchy, spicy tomato-and-chile sauce that hits sweet, hot, and savory all at once. One skillet, dinner in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
48g
20-Min Shito Chicken
comfortboldghanaianchickencrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry, then season generously with salt and black pepper on both sides.

  2. Step 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Sear chicken without moving for 3 minutes per side until golden brown, then transfer to a plate.

  4. Step 4

    In the same skillet, sauté diced onion for 2 minutes, then add minced ginger and tomato paste, stirring for 30 seconds until fragrant.

  5. Step 5

    Pour in canned tomatoes, add whole habanero, and bring to a simmer. Return chicken to skillet and cook for 5 minutes until chicken is cooked through.

  6. Step 6

    Remove from heat, discard habanero, and taste for salt and heat. Serve hot over rice or with flatbread.

Tools you’ll need

  • 12-inch cast iron or stainless steel skillet
  • plate for resting chicken
  • wooden spoon or silicone spatula
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.