Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shrimp Fried Rice

Crispy shrimp, fluffy rice, and charred vegetables tossed in a wok-hot skillet with soy and sesame. Ready in one pan, no side dishes needed.

Total time
12 min
Servings
2
Calories
385
Protein
22g
Shrimp Fried Rice
quicksatisfyingchineseshrimpcrispytenderfluffyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 1 minute.

  2. Step 2

    Add shrimp and cook without stirring for 2 minutes, then flip and cook 1 minute more until pink.

  3. Step 3

    Push shrimp to the side. Add peas and carrots to the pan, stir-fry for 2 minutes until hot.

  4. Step 4

    Add cold rice, breaking up clumps as you stir. Cook for 2 minutes, stirring constantly, until rice is hot.

  5. Step 5

    Drizzle soy sauce and sesame oil over the top. Toss everything together for 30 seconds until coated.

  6. Step 6

    Divide between bowls and top with green onions. Serve immediately.

Tools you’ll need

  • 14-inch skillet or wok
  • wooden spoon or spatula
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.