Simple Olive Oil Herb Pasta
Silky pasta coated with fruity olive oil, bright Italian herbs, and crispy Parmesan. Ready in 15 minutes—the kind of weeknight dinner that tastes restaurant-quality.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g

simplefreshitalianvegetariansilkytenderweeknightpasta
Ingredients
- 8 oz pasta (spaghetti, linguine, or penne)
- 3 tbsp olive oil
- 1 tsp italian seasoning
- ½ cup parmesan cheese, grated
Instructions
- 1
Boil pasta in salted water until al dente, about 10 minutes.
- 2
Reserve 1/4 cup pasta water, then drain the pasta.
- 3
Warm olive oil in the pot over low heat, then add Italian seasoning and stir for 30 seconds until fragrant.
- 4
Return pasta to the pot and toss with the oil, adding pasta water a splash at a time until silky.
- 5
Divide into bowls and top generously with Parmesan.
Tools you’ll need
- large pot
- colander
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



