CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Simple Olive Oil Herb Pasta

Silky pasta coated with fruity olive oil, bright Italian herbs, and crispy Parmesan. Ready in 15 minutes—the kind of weeknight dinner that tastes restaurant-quality.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Simple Olive Oil Herb Pasta
simplefreshitalianvegetariansilkytenderweeknightpasta

Ingredients

  • 8 oz pasta (spaghetti, linguine, or penne)
  • 3 tbsp olive oil
  • 1 tsp italian seasoning
  • ½ cup parmesan cheese, grated

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 10 minutes.

  2. 2

    Reserve 1/4 cup pasta water, then drain the pasta.

  3. 3

    Warm olive oil in the pot over low heat, then add Italian seasoning and stir for 30 seconds until fragrant.

  4. 4

    Return pasta to the pot and toss with the oil, adding pasta water a splash at a time until silky.

  5. 5

    Divide into bowls and top generously with Parmesan.

Tools you’ll need

  • large pot
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.