Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Smashed Pork & Potato Stomp

Crispy pork chops meet fluffy mashed potatoes and charred cabbage in this Belgian one-pan dinner. Buttery, savory, and on the table in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Smashed Pork & Potato Stomp
comfortbelgianporkcrispycreamytenderweeknightmain-dish

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch chunks and boil in salted water until fork-tender, about 12 minutes.

  2. Step 2

    Pat pork chops dry. Season with salt and pepper, then sear in a large skillet over medium-high heat with 1 tbsp butter, 90 seconds per side until golden. Transfer to a plate.

  3. Step 3

    Add cabbage to the same skillet with broth, mustard, and vinegar. Cover and simmer 6 minutes until cabbage softens and liquid reduces by half.

  4. Step 4

    Drain potatoes and mash with remaining 2 tbsp butter, salt, pepper, and thyme if using, until creamy.

  5. Step 5

    Return pork chops to the skillet to warm through, about 30 seconds. Taste the cabbage and adjust seasoning.

  6. Step 6

    Pile mashed potatoes on a plate, top with pork chop, and spoon warm cabbage alongside. Serve immediately.

Tools you’ll need

  • large pot or dutch oven
  • 12-inch skillet with lid
  • colander
  • potato masher
  • tongs
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.