CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Smashed Pork & Potato Stomp

Crispy pork chops meet fluffy mashed potatoes and charred cabbage in this Belgian one-pan dinner. Buttery, savory, and on the table in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Smashed Pork & Potato Stomp
comfortbelgianporkcrispycreamytenderweeknightmain-dish

Ingredients

  • 2 pieces (6 oz each) pork chops, boneless
  • 1 lb potatoes, russet
  • 4 cups green cabbage, chopped
  • 3 tbsp butter, divided
  • ¾ cup chicken or vegetable broth
  • 1.5 tbsp whole-grain mustard
  • 1 tbsp apple cider vinegar
  • 1 tsp (optional) fresh thyme or caraway seeds

Instructions

  1. 1

    Cut potatoes into 1-inch chunks and boil in salted water until fork-tender, about 12 minutes.

  2. 2

    Pat pork chops dry. Season with salt and pepper, then sear in a large skillet over medium-high heat with 1 tbsp butter, 90 seconds per side until golden. Transfer to a plate.

  3. 3

    Add cabbage to the same skillet with broth, mustard, and vinegar. Cover and simmer 6 minutes until cabbage softens and liquid reduces by half.

  4. 4

    Drain potatoes and mash with remaining 2 tbsp butter, salt, pepper, and thyme if using, until creamy.

  5. 5

    Return pork chops to the skillet to warm through, about 30 seconds. Taste the cabbage and adjust seasoning.

  6. 6

    Pile mashed potatoes on a plate, top with pork chop, and spoon warm cabbage alongside. Serve immediately.

Tools you’ll need

  • large pot or dutch oven
  • 12-inch skillet with lid
  • colander
  • potato masher
  • tongs
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.