Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Soft Pretzel Bites with Cheese & Mustard

Chewy homemade pretzel bites boiled in baking soda, baked until golden, then tossed with melted butter and topped with coarse salt and sharp cheddar. Perfect for snacking or sharing.

Total time
75 min
Servings
4
Calories
320
Protein
11g
Soft Pretzel Bites with Cheese & Mustard
casualcomfortamericanvegetarianchewycrispyweeknightgame-day

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, warm water, yeast, and salt in a bowl until a shaggy dough forms.

  2. Step 2

    Knead dough on a floured surface for 5 minutes until smooth and elastic.

  3. Step 3

    Transfer to an oiled bowl, cover with plastic wrap, and let rise for 45 minutes until doubled.

  4. Step 4

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  5. Step 5

    Bring a large pot of water to boil and stir in baking soda until dissolved.

  6. Step 6

    Divide dough into 16 pieces. Roll each into a 6-inch rope and tie into a pretzel shape.

  7. Step 7

    Boil pretzels in baking soda water, 2-3 at a time, for 20-30 seconds each until they float.

  8. Step 8

    Transfer boiled pretzels to the prepared baking sheet with a slotted spoon.

  9. Step 9

    Bake pretzels for 12-15 minutes until deep golden brown on top.

  10. Step 10

    Brush hot pretzels with melted butter while still on the pan.

  11. Step 11

    Sprinkle coarse salt and shredded cheddar over the warm pretzels immediately.

  12. Step 12

    Cool on the pan for 5 minutes, then transfer to a wire rack or serve warm.

Tools you’ll need

  • large mixing bowl
  • measuring cups and spoons
  • wooden spoon or whisk
  • floured work surface
  • plastic wrap
  • large pot
  • baking sheet
  • parchment paper
  • slotted spoon
  • oven
  • pastry brush
  • wire cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.