Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Southern Buttermilk Fried Chicken Biscuit

Crispy fried chicken thighs tucked into warm buttermilk biscuits with a touch of hot honey and tangy pickles. Restaurant-quality sandwich in under 30 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Southern Buttermilk Fried Chicken Biscuit
comfortindulgentsouthernchickencrispytenderflakyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season all over with salt and pepper.

  2. Step 2

    Pour buttermilk into a shallow bowl. Mix flour, salt, and pepper in another bowl.

  3. Step 3

    Dip each chicken thigh into buttermilk, then coat both sides thoroughly with seasoned flour.

  4. Step 4

    Heat oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Sear chicken 5–6 minutes per side without moving. Edges should turn deep golden and no pink remains inside.

  6. Step 6

    Transfer chicken to a plate lined with paper towels to drain. Warm biscuits in the skillet 30 seconds per side.

  7. Step 7

    Split each warm biscuit in half. Drizzle cut sides with hot honey.

  8. Step 8

    Layer one chicken thigh and 2 pickle slices on the bottom half of each biscuit. Top with the other half.

  9. Step 9

    Serve immediately while chicken and biscuits are still warm.

Tools you’ll need

  • 10-inch skillet (cast iron preferred)
  • two shallow bowls
  • paper towels
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.