Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Southern Pan-Fried Liver and Onions

Tender beef liver paired with caramelized onions in a classic Southern skillet dinner. Ready in under 30 minutes with minimal ingredients and maximum comfort-food flavor.

Total time
25 min
Servings
2
Calories
425
Protein
38g
Southern Pan-Fried Liver and Onions
comfortheartysouthernbeeftendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the liver slices dry with paper towels—this helps them brown instead of steam when they hit the hot pan.

  2. Step 2

    Peel the onions, then cut each one in half from root to tip, then turn the flat side down and slice crosswise into 1/4-inch-wide rings.

  3. Step 3

    Pour the flour into a shallow bowl or plate, then add the salt and pepper and stir with a fork until mixed evenly.

  4. Step 4

    Set a 12-inch skillet over medium-high heat and pour in 2 tablespoons of oil, then wait until it shimmers and slides quickly when you tilt the pan.

  5. Step 5

    Working with 3–4 liver slices at a time, lay each slice in the flour mixture, press gently so both sides get a light coating, then tap off excess flour.

  6. Step 6

    Lay the coated liver slices in the hot oil in a single layer—they should sizzle immediately—and cook without moving them for 2 minutes until the underside is golden-brown.

  7. Step 7

    Flip each liver slice over and cook the other side for 90 seconds until the outside is browned but the center still feels slightly soft when pressed with a finger.

  8. Step 8

    Transfer the cooked liver slices to a clean plate, then repeat steps 5–7 with the remaining liver slices using the same hot oil.

  9. Step 9

    Add the remaining 1 tablespoon of oil to the same skillet, then tip in all the onion slices and stir with a wooden spoon to coat them.

  10. Step 10

    Cook the onions over medium heat, stirring once every 2 minutes, for 12–15 minutes until they turn dark golden brown and feel completely soft when poked with a fork.

  11. Step 11

    Nestle all the cooked liver slices back into the skillet on top of the caramelized onions, then toss gently to combine and warm the liver through, about 1 minute.

Tools you’ll need

  • paper towels
  • cutting board
  • knife
  • shallow bowl or plate
  • fork
  • 12-inch skillet
  • wooden spoon
  • tongs or spatula
  • clean plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.