Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Spiced Beef Flatbreads

Crispy store-bought naan or pita topped with a quick-seared, spiced ground beef mixture and fresh herbs. Middle Eastern street food energy, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
24g
20-Min Spiced Beef Flatbreads
casualquickmiddle-easternbeefcrispytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. Step 2

    Add ground beef, breaking it up with a spoon, and cook until no pink remains, ~6 minutes.

  3. Step 3

    Stir in tomato paste, sumac, paprika, salt, and pepper; cook 1 minute until fragrant.

  4. Step 4

    Warm flatbreads in the skillet 30 seconds per side, then transfer to a plate.

  5. Step 5

    Spoon beef mixture onto each flatbread and top with fresh herbs.

  6. Step 6

    Squeeze lemon over the top and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • spoon or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.