CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Spiced Beef Flatbreads

Crispy store-bought naan or pita topped with a quick-seared, spiced ground beef mixture and fresh herbs. Middle Eastern street food energy, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
24g
20-Min Spiced Beef Flatbreads
casualquickmiddle-easternbeefcrispytenderweeknightmain-dish

Ingredients

  • ½ lb ground beef
  • 4 pieces naan or pita flatbread
  • 2 tbsp tomato paste
  • 1 tsp sumac or dried oregano
  • ½ tsp paprika
  • ½ cup fresh parsley and mint, chopped
  • 1 whole lemon

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. 2

    Add ground beef, breaking it up with a spoon, and cook until no pink remains, ~6 minutes.

  3. 3

    Stir in tomato paste, sumac, paprika, salt, and pepper; cook 1 minute until fragrant.

  4. 4

    Warm flatbreads in the skillet 30 seconds per side, then transfer to a plate.

  5. 5

    Spoon beef mixture onto each flatbread and top with fresh herbs.

  6. 6

    Squeeze lemon over the top and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • spoon or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.