Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Steamed Grouper with Ginger Scallion

Tender, flaky grouper fillets steamed in minutes with a fragrant ginger-scallion oil that hits like a restaurant dish. Pure umami, zero fuss.

Total time
15 min
Servings
2
Calories
285
Protein
36g
Steamed Grouper with Ginger Scallion
lightsimplechinesefishtenderflakyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set up a steamer: fill a pot with 1 inch water, place a steamer basket or bamboo steamer on top, and bring water to a rolling boil.

  2. Step 2

    Pat grouper fillets dry with paper towels. Arrange on a heatproof plate, season lightly with salt and pepper.

  3. Step 3

    Slice 2 scallions into thin rings; set aside for garnish. Chop the remaining 2 scallions into 1-inch pieces.

  4. Step 4

    Slide the plate of grouper into the steamer. Cover and steam for 6–8 minutes until fish flakes easily at the thickest part.

  5. Step 5

    Heat neutral oil in a small skillet over medium-high for 90 seconds until it shimmers. Add ginger and chopped scallions, stir for 30 seconds until fragrant.

  6. Step 6

    Remove from heat. Stir in soy sauce and sesame oil. Pour the ginger-scallion oil over the steamed grouper and garnish with sliced scallions. Serve immediately.

Tools you’ll need

  • steamer basket or bamboo steamer
  • medium pot
  • heatproof plate
  • paper towels
  • small skillet
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.