Sticky Honey BBQ Wings
Chicken wings tossed with BBQ sauce and honey, roasted until caramelized and sticky. Serve with celery sticks and dipping sauce for a classic weeknight dinner.
- Total time
- 25 min
- Servings
- 4
- Calories
- 485
- Protein
- 38g

comfortcasualamericanchickencrispystickytenderweeknight
Ingredients
- 2 lbs chicken wings
- ¾ cup bbq sauce
- ¼ cup honey
Instructions
- 1
Pat wings dry with paper towels and toss with salt and pepper.
- 2
Spread wings on a sheet pan and roast at 425°F for 15 minutes.
- 3
Whisk BBQ sauce and honey together, then pour over wings and toss well.
- 4
Roast another 8 minutes until sauce is sticky and edges caramelize.
- 5
Serve hot with celery sticks and a side dipping sauce of your choice.
Tools you’ll need
- sheet pan
- paper towels
- small bowl for mixing
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



