Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sticky Honey BBQ Wings

Chicken wings tossed with BBQ sauce and honey, roasted until caramelized and sticky. Serve with celery sticks and dipping sauce for a classic weeknight dinner.

Total time
25 min
Servings
4
Calories
485
Protein
38g
Sticky Honey BBQ Wings
comfortcasualamericanchickencrispystickytenderweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat wings dry with paper towels and toss with salt and pepper.

  2. Step 2

    Spread wings on a sheet pan and roast at 425°F for 15 minutes.

  3. Step 3

    Whisk BBQ sauce and honey together, then pour over wings and toss well.

  4. Step 4

    Roast another 8 minutes until sauce is sticky and edges caramelize.

  5. Step 5

    Serve hot with celery sticks and a side dipping sauce of your choice.

Tools you’ll need

  • sheet pan
  • paper towels
  • small bowl for mixing
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.