Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Strozzapreti al Pomodoro & Mozzarella

Twisted pasta in a bright tomato sauce with fresh mozzarella and basil—ready in under 25 minutes. No cream, no fuss, just silky Italian comfort.

Total time
25 min
Servings
4
Calories
520
Protein
20g
Strozzapreti al Pomodoro & Mozzarella
comfortsimpleitalianvegetarianvegetariantendersilkyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot over high heat. Add strozzapreti and cook until al dente, ~9 minutes.

  2. Step 2

    While pasta cooks, heat olive oil in a large skillet over medium. Add sliced garlic and red pepper flakes, stirring until fragrant, ~60 seconds.

  3. Step 3

    Pour in canned tomatoes, crushing by hand. Simmer, stirring occasionally, until sauce thickens slightly, ~6 minutes.

  4. Step 4

    Drain pasta, reserving 1 cup pasta water. Add pasta to the skillet and toss gently.

  5. Step 5

    Remove from heat. Scatter torn mozzarella and basil over the top, stirring gently to melt.

  6. Step 6

    If sauce is too thick, add pasta water 2 tablespoons at a time. Season with salt and pepper, then serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.