CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Stuffed Peppers with Roasted Chili

Ground beef, rice, and cheese stuffed into bell peppers with a charred roasted chili on the side. Everything cooks together on one sheet pan in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
28g
15-Min Stuffed Peppers with Roasted Chili
comfortquickmexicanbeeftendercrispyweeknightmain-dish

Ingredients

  • ½ lb ground beef
  • 1 cup cooked rice
  • ¾ cup shredded cheddar cheese
  • 2 whole bell peppers, halved and seeded
  • 1 whole poblano or green chili pepper
  • ½ cup diced tomato (fresh or canned)

Instructions

  1. 1

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, about 4 minutes.

  2. 2

    Stir cooked rice, half the cheese, diced tomato, salt, and pepper into the beef. Mix until combined, about 1 minute.

  3. 3

    Spoon filling into bell pepper halves. Arrange on a sheet pan alongside the poblano. Drizzle everything with oil.

  4. 4

    Broil 6 inches from heat until peppers char at the edges and filling is hot, 8–10 minutes.

  5. 5

    Scatter remaining cheese over stuffed peppers. Broil 1 more minute until melted.

  6. 6

    Serve stuffed peppers warm with the charred poblano on the side.

Tools you’ll need

  • skillet (10-inch or larger)
  • wooden spoon
  • sheet pan
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.