Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Stuffed Peppers with Roasted Chili

Ground beef, rice, and cheese stuffed into bell peppers with a charred roasted chili on the side. Everything cooks together on one sheet pan in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
28g
15-Min Stuffed Peppers with Roasted Chili
comfortquickmexicanbeeftendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, about 4 minutes.

  2. Step 2

    Stir cooked rice, half the cheese, diced tomato, salt, and pepper into the beef. Mix until combined, about 1 minute.

  3. Step 3

    Spoon filling into bell pepper halves. Arrange on a sheet pan alongside the poblano. Drizzle everything with oil.

  4. Step 4

    Broil 6 inches from heat until peppers char at the edges and filling is hot, 8–10 minutes.

  5. Step 5

    Scatter remaining cheese over stuffed peppers. Broil 1 more minute until melted.

  6. Step 6

    Serve stuffed peppers warm with the charred poblano on the side.

Tools you’ll need

  • skillet (10-inch or larger)
  • wooden spoon
  • sheet pan
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.