Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sweet and Sour Shrimp

Tender shrimp tossed in a glossy sweet and sour sauce with bell peppers and pineapple. Ready in 20 minutes with minimal prep and just one pan.

Total time
20 min
Servings
2
Calories
318
Protein
35g
Sweet and Sour Shrimp
quicksatisfyingchineseshrimptenderjuicyweeknightstir-fry

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry with paper towels by pressing them gently between sheets, so they will brown properly instead of steaming.

  2. Step 2

    Slice the bell pepper lengthwise from the stem end to the tip into quarters, then remove the white core and seeds, then slice crosswise into bite-sized pieces roughly the width of your pinky finger.

  3. Step 3

    Stir together the rice vinegar, honey, and soy sauce in a small bowl until the honey dissolves and you see a uniform liquid.

  4. Step 4

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. Step 5

    Add the shrimp in a single layer and cook for 2 minutes without stirring, so they develop a light golden sear on the bottom side.

  6. Step 6

    Flip each shrimp with tongs and cook for another 1 minute until the other side is light golden and the shrimp are firm to touch.

  7. Step 7

    Push the shrimp to one side of the skillet, then add the bell pepper pieces to the empty side and cook for 2 minutes, stirring once halfway through.

  8. Step 8

    Pour the sauce mixture into the center of the skillet and stir gently for 1 minute until everything is coated and the liquid turns glossy.

  9. Step 9

    Add the pineapple chunks and stir gently for 30 seconds until they are warmed through and coated with sauce.

  10. Step 10

    Taste a shrimp and a piece of pepper; add salt and pepper as needed until the flavor is balanced between sweet, tangy, and savory.

Tools you’ll need

  • 12-inch skillet with lid
  • paper towels
  • cutting board
  • chef's knife
  • small mixing bowl
  • wooden spoon or spatula
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.